en · de · pt
purity-notes.peptides8425.com › News › Melanocortin Receptor Pharmacology — Deep Dive

Melanocortin Receptor Pharmacology — Deep Dive

By Editorial Desk · published 2026-03-29 · last reviewed 2026-05-08 · News

MC4R is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.

Updated 2026-05-08. Numbers and descriptions here follow the published literature rather than marketing material.

Melanocortin Receptor Pharmacology

Compared with melanotan II, bremelanotide is a smaller cyclic peptide with a more constrained backbone, which affects receptor selectivity and metabolic stability. Published descriptions give a plasma half-life on the order of a few hours after subcutaneous administration, with elimination through hepatic and renal routes and limited plasma protein binding. Central access is inferred from effects observed in animal models, although direct measurement in humans is limited. Handling and storage requirements follow from the peptide backbone, which is susceptible to hydrolysis and oxidation.

The melanocortin system comprises five G protein-coupled receptors, designated MC1 through MC5, that signal mainly through cyclic AMP accumulation. MC1R and MC2R are associated with pigmentation and adrenal steroid production, while MC3R and MC4R are expressed in the central nervous system and influence energy balance and behavior. MC5R appears in exocrine tissues. Natural agonists include alpha-melanocyte-stimulating hormone and adrenocorticotropic hormone, and endogenous antagonists such as agouti-related protein modulate the same sites. This receptor family provides the framework within which bremelanotide activity is described.

Receptor Pharmacology and Study Measures

After subcutaneous administration, plasma concentrations rise within roughly thirty minutes and the elimination half-life is short, on the order of two to three hours. Reported physiological responses include transient increases in blood pressure and nausea, which tended to diminish with repeated dosing in trial settings. Because the peptide clears quickly, effects are not expected to persist long after a dose. Absorption from non-injected routes is poorly characterised, and nasal delivery produced variable plasma levels in older work.

Clinical research typically uses randomised, double-blind, placebo-controlled designs. The most common primary endpoint is the desire domain score of the Female Sexual Function Index, sometimes paired with a distress measure. Secondary outcomes include arousal, satisfaction, and event-based counts of satisfying sexual episodes. Across trials, average improvements are modest and individual responses vary widely. Whether benefits persist beyond a few months, and whether they depend on baseline hormone status, remain open questions rather than settled findings.

Melanocortin receptors form a family of five G-protein-coupled receptors designated MC1 through MC5. Bremelanotide binds most strongly at MC4R and MC1R, with weaker activity reported at MC3R and MC5R. MC4R is expressed in hypothalamic nuclei that coordinate energy balance and aspects of sexual behaviour. The prevailing interpretation is that central MC4R activation, rather than peripheral vascular effects alone, drives the reported changes in desire. This account remains partly inferential, since direct receptor-level measurement in living humans is not practical.

Pt-141 at a glance

PropertyValueNotes
Primary receptor targetMC4RHighest reported agonist potency within the family
Secondary receptor activityMC1R and MC3RLower potency than at MC4R
Elimination half-lifeAbout 2 to 3 hoursMeasured after subcutaneous administration
Plasma protein bindingApproximately 44 percentSpecies- and assay-dependent
Route of administrationSubcutaneous injectionReviewed product uses a single-use device

Storage Stability and Analytical Methods

Lyophilised peptide is generally held below minus twenty degrees Celsius, protected from light and moisture, because hydrolysis and oxidation accumulate faster at ambient temperature. Once reconstituted, solutions are typically kept between two and eight degrees Celsius and used within a short window defined by the supplier. Repeated freeze-thaw cycles are avoided since they promote aggregation and loss of soluble material. Container material matters as well, because peptides adsorb to certain plastics and glass surfaces at low concentration. Stability figures supplied by a vendor apply only to the specific lot and buffer that were tested.

Identity and purity are usually established with reversed-phase high-performance liquid chromatography combined with mass spectrometry. A gradient of water and acetonitrile containing trifluoroacetic acid is a common mobile phase, and ultraviolet detection near 214 nanometres responds to the peptide backbone. Mass spectrometry confirms the expected molecular mass and helps reveal truncation or oxidation products. Purity is reported as a peak-area percentage, a figure that depends on the wavelength and gradient used, so values from different laboratories are not always directly comparable. Peptide mapping and amino acid analysis provide additional confirmation when required.

Related pages on this site

Receptor Mechanism And Pharmacokinetics

After subcutaneous dosing, peak plasma concentrations appear within roughly one hour, and elimination is fast, with a half-life on the order of a few hours. Degradation is mainly proteolytic, and at least one circulating fragment retains receptor activity, so parent-drug levels alone do not describe total exposure. Clearance does not depend heavily on hepatic cytochrome enzymes, which lowers the likelihood of common metabolic interaction routes. Data in renal or hepatic impairment are limited. Repeated dosing does not appear to produce marked accumulation given the short half-life.

Reported pharmacodynamic effects include transient rises in blood pressure and heart rate, flushing, nausea and headache, appearing soon after dosing and resolving within hours. These responses were dose-related in early studies and shaped the label's cardiovascular cautions and blood pressure monitoring advice. Gastrointestinal upset is the most frequent reason cited for discontinuation in trials. Whether the vascular signal attenuates with repeated use is not settled. Central effects on desire are described as emerging over weeks rather than immediately, which points to a cumulative rather than acute process.

The compound binds several melanocortin receptor subtypes rather than a single target, with the strongest functional activity reported at MC4R and measurable activity at MC1R, MC3R and MC5R. MC4R populations are dense in hypothalamic nuclei that integrate energy balance, autonomic tone and reproductive behaviour, which is the anatomical basis for the proposed pro-desire effect. Because binding is not subtype-selective, pigmentary and vascular effects accompany central activity. Improving subtype selectivity is an active area of analogue design. Direct causal mapping from receptor occupancy to reported desire change in humans is not fully established.

Analytical Methods and Storage Practice

Identity and purity testing for this peptide typically relies on reversed-phase high-performance liquid chromatography with ultraviolet detection, reported as area-percent purity. Mass spectrometry, usually in tandem mode, confirms molecular mass and supports quantification in biological matrices. Sequence confirmation may use peptide mapping after enzymatic digestion, while nuclear magnetic resonance and circular dichroism supply supplementary structural detail. No single technique establishes identity alone, so laboratories compare retention time, mass, and fragment pattern against a verified reference standard.

The lactam ring that closes the peptide backbone improves resistance to exopeptidase attack, but the molecule stays susceptible to hydrolysis and oxidation once dissolved. Degradation accelerates with temperature, extreme pH, and light exposure, and repeated freeze-thaw cycles promote aggregation and material loss. Lyophilized powder held desiccated at or below minus twenty degrees Celsius is the common way to keep reference material. Reconstituted solutions are generally kept cold and used within a short window because their stability is far lower than that of the dry solid.

Handling procedures emphasize minimizing moisture uptake, since the dried solid is hygroscopic and can draw water when warmed to room temperature before a vial is opened. Laboratories record lot number, purity, counter-ion content, and residual solvent data supplied by the producer. Impurity profiles are compared run to run, and any shift in retention time or peak shape prompts re-verification against a reference standard. Certificates of analysis are treated as claims to be checked rather than accepted at face value.

Supporting material

It is a bioactive sphingoid which derives from the sphinganine. It is formed by a sphingoid and an amino alcohol and it constitutes the conjugated base of 1-deoxymethylsphinganine (1+). Its role is accepting a hydron from a donor via its organic amino compound; it is a Brønsted base. It is also known as deoxymethyl-SA, (2R)-1-aminoheptadecan-2-ol and 1-desoxymethylsphinganine. The molecular weight of this compound is 271,48 g/mol and its molecular formula is C17H37NO, which means it has 17 carbons. In relation to its appearance, it has a powder form. Other physical and chemical properties are not certainly known.

Vehicle inspection is a procedure mandated by national or subnational governments in many countries, in which a vehicle is inspected to ensure that it conforms to regulations governing safety, emissions, or both. Inspection can be required at various times, e.g., periodically or on the transfer of title to a vehicle. If required periodically, it might be termed periodic motor vehicle inspection, or MOT test in the UK, or roadworthiness test in EU directives. Typical intervals are every two years (in EU) and every year (in UK). When a vehicle passes inspection, often a sticker is placed on the vehicle's windshield or registration plate to simplify later controls, but in some countries (such as Netherlands since 1994) this is no longer necessary. Vehicles are tested at inspection stations when due for inspection. Most US inspection decals/stickers display the month's number and the year. They are called testing centre in EU directives. Vehicle inspection exists in the United States. In Victoria, Australia, safety features checked include the structure of the vehicle, the tires (depth of tread), the wheels, the engine, steering, suspension, brakes, and lights and seatbelts.

Fermentation is the metabolism of organic compounds in the absence of air. It involves substrate-level phosphorylation in the absence of a respiratory electron transport chain. The equation for the reaction of glucose to form lactic acid is: C6H12O6 + 2 ADP + 2 Pi → 2 CH3CH(OH)COOH + 2 ATP + 2 H2O Anaerobic respiration is respiration in the absence of O2. Prokaryotes can utilize a variety of electron acceptors. These include nitrate, sulfate, and carbon dioxide. In anaerobic organisms and prokaryotes, different pathways result in ATP. ATP is produced in the chloroplasts of green plants in a process similar to oxidative phosphorylation, called photophosphorylation. ATP can also be synthesized through several so-called "replenishment" reactions catalyzed by the enzyme families of nucleoside diphosphate kinases (NDKs), which use other nucleoside triphosphates as a high-energy phosphate donor, and the ATP:guanido-phosphotransferase family.

It might occur either at the enzyme or receptor level. There are two possible outcomes at the enzyme level: competitive inhibition or enzyme activity reactivation. Ethyl alcohol or fomepizole used in methyl alcohol or ethylene glycol poisoning is a typical example of competitive enzyme inhibition. By posing competition for alcohol dehydrogenase (ADH) with methyl alcohol and ethylene glycol, these drugs reduce the production of harmful metabolites. For receptor level, the traditional antidotes include naloxone and flumazenil. Flumazenil functions as a competitive antagonist at the GABA-A receptor complex's benzodiazepine site. By doing this, the CNS and respiratory depression would reverse and the inward chloride current would reduce. Flumazenil is useful in treating and preventing benzodiazepine-induced coma from recurring.

Sources: en.wikipedia.org

Notes from published material

pcALCL is the second most common lymphoma in the category of Cutaneous T cell lymphoma cutaneous T cell lymphomas that includes lymphomatoid papulosis, various borderline CD30-positive cutaneous T cell lymphomas, and mycosis fungoides. The median age at diagnosis for pcALC is 61 years. The disease has a male predominance and appears to be more common in Caucasian populations. Individuals with pcALCL typically present with reddish masses that initially appear in the skin or, much less frequently, the lymph nodes or various organs. These masses are nodules or tumors that are often ulcerated, greater than 2 cm in diameter, and localized to a single site. In 20% of cases, however, they occur in multiple sites. In about 10% cases followed for many years, pcALCL presenting as skin lesions progresses to extracutaneous sites, mainly to regional draining lymph nodes. Over these same long periods, however, the disease's lesions partially regress in about 50% of cases but then relapse in about 40% of cases.

Individual transmembrane adenylyl cyclase isoforms have been linked to numerous physiological functions. Soluble adenylyl cyclase (sAC, AC10) has a critical role in sperm motility. Adenylyl cyclase has been implicated in memory formation, functioning as a coincidence detector. AC-IV was first reported in the bacterium Aeromonas hydrophila, and the structure of the AC-IV from Yersinia pestis has been reported. These are the smallest of the AC enzyme classes; the AC-IV (CyaB) from Yersinia is a dimer of 19 kDa subunits with no known regulatory components (PDB: 2FJT​). AC-IV forms a superfamily with mammalian thiamine-triphosphatase called CYTH (CyaB, thiamine triphosphatase). These forms of AC have been reported in specific bacteria (Prevotella ruminicola O68902 and Rhizobium etli Q8KY20, respectively) and have not been extensively characterized. There are a few extra members (~400 in Pfam) known to be in class VI. Class VI enzymes possess a catalytic core similar to the one in Class III.

ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).

Sources: en.wikipedia.org

Further detail

No chromosome translocations, chimeric genes, or fusion proteins have been described in BIA-ALCL although the neoplastic cells in the disease have been described to have gene copy number variations involving gains in gene copies on the p arm of chromosome 19 and losses of gene copies in the p arms of chromosome 10 and 1. The neoplastic cells in BIA-ALCL show mutations of the STAT3 gene in 64% of cases and reports of mutations in JAK1, JAK3, DNMT3A, and TP53 genes. The development of BIA-ALCL, it has often been suggested, may be at least in part a T-cell-induced, inflammation-driven cancer response to the implant.

A third, only marginally related concept was proposed in 1923 by Gilbert N. Lewis, which includes reactions with acid–base characteristics that do not involve a proton transfer. A Lewis acid is a species that accepts a pair of electrons from another species; in other words, it is an electron pair acceptor. Brønsted acid–base reactions are proton transfer reactions while Lewis acid–base reactions are electron pair transfers. Many Lewis acids are not Brønsted–Lowry acids. Contrast how the following reactions are described in terms of acid–base chemistry:

Cl−indicators can be designed on the basis of endogenously expressed fluorescent proteins such as Yellow fluorescent protein (YFP). An advantage of endogenously expressed probes over dye-based probes is their ability to achieve cell-type-specificity by the choice of Promoter (genetics) promotor. YFP based indicators are mutated forms of Green fluorescent protein (GFP). YFP contains four point mutations and has a red-shifted excitation and emission spectrum compared with GFP. YFP fluorescence is sensitive to various small anions with relative potencies iodine > nitrate > chloride > bromide > formate > acetate. YFP sensitivity to these small anions results from ground-state binding near the chromophore, which apparently alters the chromophore ionization constant and hence the fluorescence emission. The fluorescence of YFP is sensitive to [Cl− ] and pH. The effect is fully reversible. YFP is excited at visible range and is a genetically encoded probe. YFP based Cl− sensors have rather low kinetics of Cl− association / dissociation. The half time association/dissociation constants for YFP mutant range from 50 ms (YFP-H148Q I152L) to 2 sec (YFP-H148Q V163S). If a fluorescent indicators is based on one fluorescent protein only, it doesn't allow for ratiometric measurements. Hence, a rationale for ratiometric fluorescent indicators results.

A property of DNA is its ability to re-anneal into double-stranded molecules when pH conditions are neutralized. Under neutral conditions, hydrogen bonds reform between complementary base pairs. Because the plasmid was so tightly coiled and small before the alkaline conditions were established, it can easily re-anneal. The chromosomal DNA, however, because of its lengthy strands, does not re-anneal. Once the plasmid DNA reassociates into double-stranded molecules, it dissolves into the solution. Potassium acetate reacts with the SDS detergent, magnesium ions, and calcium ions already present in the solution and forms potassium dodecyl sulfate (KDS), an insoluble white solid which precipitates out of solution. The remaining chromosomal DNA strands, denatured proteins, and added chemicals stick together and precipitate out with the KDS. The plasmid DNA, however, remains dissolved in the liquid solution. The solution is usually centrifuged to collect the insoluble precipitates into a debris pellet at the bottom of the sample tube and thereby isolate them from the supernatant.

Sources: en.wikipedia.org

Frequently asked questions

Which receptors does bremelanotide activate?

Reported activity is highest at MC4R, with lower potency at MC1R and MC3R. The MC4R interaction is generally treated as the most relevant to its central effects. Selectivity is not absolute, and activity across the family is dose-dependent.

Does the compound reach the brain?

Indirect evidence from animal studies supports central access, and the proposed mechanism requires it. Direct quantification in humans is limited. How much reaches specific brain regions remains an open question.

What is known about its half-life?

Published descriptions give a plasma half-life of roughly two to three hours after subcutaneous administration. Values vary with assay method and study population. The figure is an average rather than a fixed molecular property.

What does the evidence show about average effect size?

Trial results generally show a small to moderate average improvement in desire scores relative to placebo. The distribution of responses is wide, and some participants show little measurable change. Group averages should not be read as a prediction for any single person.

Network